PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_62730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 243aa    MW: 26588.6 Da    PI: 9.8908
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_62730.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.41.1e-33135191158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF
  MLOC_62730.1 135 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 191
                   69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-38133194IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.328134194IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.0E-29136191IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-25137159IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860139159IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-25168191IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MRRKQNMHEN GTIMIQFGQQ VPNYESSASD SPREVSGMSE GSFNEQNDQS GNRDGYTKSD  60
EGKMMSALSL GNSETAYTPP KPDRTHPFAI SYPYADPYYG GAVAAYGTHA IMHPQMVGMV  120
PSSRVPLPIE PAAAEEPIYV NAKQYHAILR RRQLRAKLEA ENKLVKSRKP YLHESRHQHA  180
MKRARGTGGR FLNAKEKSEA ASGGGNASAR SGHASVPADG GMFSKHDHTL PSGDFHYRAR  240
GGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-24135198265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3553720.0AK355372.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1019N07.
GenBankAK3605280.0AK360528.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1119O03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754217.11e-148PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ945M95e-41NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLF2CUS00.0F2CUS0_HORVD; Predicted protein
STRINGMLOC_62730.11e-180(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-36nuclear factor Y, subunit A3